Lineage for d2za7a_ (2za7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2700898Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (83 PDB entries)
  8. 2700899Domain d2za7a_: 2za7 A: [154275]
    automated match to d1data_
    mutant

Details for d2za7a_

PDB Entry: 2za7 (more details), 1.4 Å

PDB Description: recombinant horse L-chain apoferritin N-terminal deletion mutant (residues 1-4)
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2za7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2za7a_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
irqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekregae
rllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqadp
hlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh

SCOPe Domain Coordinates for d2za7a_:

Click to download the PDB-style file with coordinates for d2za7a_.
(The format of our PDB-style files is described here.)

Timeline for d2za7a_: