SCOPe 2.06: Domain d2za5d_: 2za5 D:

Lineage for d2za5d_ (2za5 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (20 PDB entries)

8. Domain d2za5d_: 2za5 D: [154273]
   automated match to d1a0la_
   complexed with 2ff

Details for d2za5d_

PDB Entry: 2za5, 2.3 Å

PDB Description: crystal structure of human tryptase with potent non-peptide inhibitor

PDB Compounds: (D:) Tryptase beta 2

SCOPe Domain Sequences for d2za5d_:

Sequence; same for both SEQRES and ATOM records:

>d2za5d_ b.47.1.2 (D:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2za5d_:

• d2za5d_ first appeared in SCOP 1.75, called d2za5d1
  
• d2za5d_ appears in SCOPe 2.05
  
• d2za5d_ appears in SCOPe 2.07
  
• d2za5d_ appears in the current release, SCOPe 2.08