Lineage for d2za5c_ (2za5 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404556Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 2404557Species Human (Homo sapiens) [TaxId:9606] [50547] (22 PDB entries)
  8. 2404607Domain d2za5c_: 2za5 C: [154272]
    automated match to d1a0la_
    complexed with 2ff

Details for d2za5c_

PDB Entry: 2za5 (more details), 2.3 Å

PDB Description: crystal structure of human tryptase with potent non-peptide inhibitor
PDB Compounds: (C:) Tryptase beta 2

SCOPe Domain Sequences for d2za5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2za5c_ b.47.1.2 (C:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2za5c_:

Click to download the PDB-style file with coordinates for d2za5c_.
(The format of our PDB-style files is described here.)

Timeline for d2za5c_: