Lineage for d2za1b1 (2za1 B:1-318)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814448Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 814562Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 814566Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (7 PDB entries)
  8. 814580Domain d2za1b1: 2za1 B:1-318 [154265]
    automatically matched to d2f84a1
    complexed with omp

Details for d2za1b1

PDB Entry: 2za1 (more details), 2.65 Å

PDB Description: Crystal Structure of orotidine 5'-monophosphate decarboxylase complexed with orotidine 5'-monophosphate from P.falciparum
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d2za1b1:

Sequence, based on SEQRES records: (download)

>d2za1b1 c.1.2.3 (B:1-318) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailk

Sequence, based on observed residues (ATOM records): (download)

>d2za1b1 c.1.2.3 (B:1-318) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvf
dylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeekn
kyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvga
nsydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknpypq
kaaqmyydqinailk

SCOP Domain Coordinates for d2za1b1:

Click to download the PDB-style file with coordinates for d2za1b1.
(The format of our PDB-style files is described here.)

Timeline for d2za1b1: