Lineage for d2za1a_ (2za1 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1815849Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1815989Protein automated matches [190130] (11 species)
    not a true protein
  7. 1816016Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [187245] (4 PDB entries)
  8. 1816023Domain d2za1a_: 2za1 A: [154264]
    automated match to d2f84a1
    complexed with omp

Details for d2za1a_

PDB Entry: 2za1 (more details), 2.65 Å

PDB Description: Crystal Structure of orotidine 5'-monophosphate decarboxylase complexed with orotidine 5'-monophosphate from P.falciparum
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2za1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2za1a_ c.1.2.3 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailk

SCOPe Domain Coordinates for d2za1a_:

Click to download the PDB-style file with coordinates for d2za1a_.
(The format of our PDB-style files is described here.)

Timeline for d2za1a_: