![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (20 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (19 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (114 PDB entries) |
![]() | Domain d2hhbd_: 2hhb D: [15425] Other proteins in same PDB: d2hhba_, d2hhbc_ complexed with hem, po4 |
PDB Entry: 2hhb (more details), 1.74 Å
SCOP Domain Sequences for d2hhbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhbd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d2hhbd_: