Lineage for d2z9ia2 (2z9i A:6-226)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055759Protein Protease PepD [141383] (1 species)
  7. 2055760Species Mycobacterium tuberculosis [TaxId:1773] [141384] (2 PDB entries)
    Uniprot O53896 154-374
    Rv0983
  8. 2055761Domain d2z9ia2: 2z9i A:6-226 [154249]
    Other proteins in same PDB: d2z9ia1, d2z9ib1, d2z9ic1
    automated match to d1y8ta2

Details for d2z9ia2

PDB Entry: 2z9i (more details), 2 Å

PDB Description: Crystal structure of RV0983 from Mycobacterium tuberculosis- Proteolytically active form
PDB Compounds: (A:) probable serine protease pepd

SCOPe Domain Sequences for d2z9ia2:

Sequence, based on SEQRES records: (download)

>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]}
gsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplgspppk
ttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplg
legtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaqlvgvns
aiatlgadsadaqsgsiglgfaipvdqakriadelistgka

Sequence, based on observed residues (ATOM records): (download)

>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]}
gsveqvaakvvpsvvmletdleegsgiilsaegliltnnhviaaaakppkttvtfsdgrt
apftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgiv
salnrpvstntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlqsgsiglgfaip
vdqakriadelistgka

SCOPe Domain Coordinates for d2z9ia2:

Click to download the PDB-style file with coordinates for d2z9ia2.
(The format of our PDB-style files is described here.)

Timeline for d2z9ia2: