SCOP 1.75: Domain d2z9he1: 2z9h E:1-95

Lineage for d2z9he1 (2z9h E:1-95)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.15: EutN/CcmL-like [159133] (1 family)
   homohexameric unit

5. Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins)
   Pfam PF03319

6. Protein Ethanolamine utilization protein EutN [159135] (1 species)

7. Species Escherichia coli [TaxId:562] [159136] (2 PDB entries)
   Uniprot P0AEJ9 1-95

8. Domain d2z9he1: 2z9h E:1-95 [154246]
   automatically matched to 2HD3 A:1-95
   complexed with cl, mrd

Details for d2z9he1

PDB Entry: 2z9h, 2.71 Å

PDB Description: ethanolamine utilization protein, eutn

PDB Compounds: (E:) Ethanolamine utilization protein eutN

SCOP Domain Sequences for d2z9he1:

Sequence; same for both SEQRES and ATOM records:

>d2z9he1 b.40.15.1 (E:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg
ssarqahksetspvdlcvigivdevvsggqvifhk

Timeline for d2z9he1:

• d2z9he1 is new in SCOP 1.75
  
• d2z9he1 is called d2z9he_ in SCOPe 2.01
  
• d2z9he1 appears in the current release, SCOPe 2.08, called d2z9he2