Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins) Pfam PF03319 |
Protein Ethanolamine utilization protein EutN [159135] (1 species) |
Species Escherichia coli [TaxId:562] [159136] (2 PDB entries) Uniprot P0AEJ9 1-95 |
Domain d2z9he1: 2z9h E:1-95 [154246] automatically matched to 2HD3 A:1-95 complexed with cl, mrd |
PDB Entry: 2z9h (more details), 2.71 Å
SCOP Domain Sequences for d2z9he1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z9he1 b.40.15.1 (E:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]} mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg ssarqahksetspvdlcvigivdevvsggqvifhk
Timeline for d2z9he1: