SCOPe 2.07: Domain d2z9hd2: 2z9h D:1-95

Lineage for d2z9hd2 (2z9h D:1-95)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.15: EutN/CcmL-like [159133] (2 families)
   homohexameric unit

5. Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
   Pfam PF03319

6. Protein Ethanolamine utilization protein EutN [159135] (1 species)

7. Species Escherichia coli [TaxId:562] [159136] (2 PDB entries)
   Uniprot P0AEJ9 1-95

8. Domain d2z9hd2: 2z9h D:1-95 [154245]
   Other proteins in same PDB: d2z9ha3, d2z9hb3, d2z9hd3, d2z9he3
   automated match to d2hd3a1
   complexed with cl, mrd

Details for d2z9hd2

PDB Entry: 2z9h, 2.71 Å

PDB Description: ethanolamine utilization protein, eutn

PDB Compounds: (D:) Ethanolamine utilization protein eutN

SCOPe Domain Sequences for d2z9hd2:

Sequence; same for both SEQRES and ATOM records:

>d2z9hd2 b.40.15.1 (D:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg
ssarqahksetspvdlcvigivdevvsggqvifhk

Timeline for d2z9hd2:

• d2z9hd2 first appeared in SCOP 1.75, called d2z9hd1
  
• d2z9hd2 appears in SCOPe 2.06
  
• d2z9hd2 appears in the current release, SCOPe 2.08