Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
Protein Ethanolamine utilization protein EutN [159135] (1 species) |
Species Escherichia coli [TaxId:562] [159136] (2 PDB entries) Uniprot P0AEJ9 1-95 |
Domain d2z9hb2: 2z9h B:1-95 [154243] Other proteins in same PDB: d2z9ha3, d2z9hb3, d2z9hd3, d2z9he3 automated match to d2hd3a1 complexed with cl, mrd |
PDB Entry: 2z9h (more details), 2.71 Å
SCOPe Domain Sequences for d2z9hb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z9hb2 b.40.15.1 (B:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]} mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg ssarqahksetspvdlcvigivdevvsggqvifhk
Timeline for d2z9hb2: