Lineage for d2z9ha2 (2z9h A:1-95)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400823Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) (S)
    homohexameric unit
  5. 2400824Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 2400886Protein Ethanolamine utilization protein EutN [159135] (1 species)
  7. 2400887Species Escherichia coli [TaxId:562] [159136] (2 PDB entries)
    Uniprot P0AEJ9 1-95
  8. 2400900Domain d2z9ha2: 2z9h A:1-95 [154242]
    Other proteins in same PDB: d2z9ha3, d2z9hb3, d2z9hd3, d2z9he3
    automated match to d2hd3a1
    complexed with cl, mrd

Details for d2z9ha2

PDB Entry: 2z9h (more details), 2.71 Å

PDB Description: ethanolamine utilization protein, eutn
PDB Compounds: (A:) Ethanolamine utilization protein eutN

SCOPe Domain Sequences for d2z9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9ha2 b.40.15.1 (A:1-95) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg
ssarqahksetspvdlcvigivdevvsggqvifhk

SCOPe Domain Coordinates for d2z9ha2:

Click to download the PDB-style file with coordinates for d2z9ha2.
(The format of our PDB-style files is described here.)

Timeline for d2z9ha2: