Lineage for d2z9db1 (2z9d B:1-200)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982673Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 982821Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 982822Protein ACP phosphodiesterase AcpD [110470] (2 species)
    evolved new enzymatic activity
  7. 982823Species Escherichia coli [TaxId:562] [110471] (7 PDB entries)
    Uniprot P41407
  8. 982828Domain d2z9db1: 2z9d B:1-200 [154240]
    automatically matched to d1tika_
    complexed with fmn

Details for d2z9db1

PDB Entry: 2z9d (more details), 2.1 Å

PDB Description: The crystal structure of AzoR (azoreductase) from Escherichia coli: Oxidized AzoR in orthorhombic crystals
PDB Compounds: (B:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d2z9db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9db1 c.23.5.3 (B:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]}
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
emaakaqsdakaaidsivsa

SCOPe Domain Coordinates for d2z9db1:

Click to download the PDB-style file with coordinates for d2z9db1.
(The format of our PDB-style files is described here.)

Timeline for d2z9db1: