![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
![]() | Protein ACP phosphodiesterase AcpD [110470] (2 species) evolved new enzymatic activity |
![]() | Species Escherichia coli [TaxId:562] [110471] (7 PDB entries) Uniprot P41407 |
![]() | Domain d2z9db_: 2z9d B: [154240] automated match to d2z98a1 complexed with fmn |
PDB Entry: 2z9d (more details), 2.1 Å
SCOPe Domain Sequences for d2z9db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z9db_ c.23.5.3 (B:) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp emaakaqsdakaaidsivsa
Timeline for d2z9db_: