Lineage for d2z9da_ (2z9d A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439266Family c.23.5.3: Quinone reductase [52235] (4 protein domains)
    binds FAD
  6. 2439267Protein ACP phosphodiesterase AcpD [110470] (2 species)
    evolved new enzymatic activity
  7. 2439268Species Escherichia coli [TaxId:562] [110471] (7 PDB entries)
    Uniprot P41407
  8. 2439272Domain d2z9da_: 2z9d A: [154239]
    automated match to d2z98a1
    complexed with fmn

Details for d2z9da_

PDB Entry: 2z9d (more details), 2.1 Å

PDB Description: The crystal structure of AzoR (azoreductase) from Escherichia coli: Oxidized AzoR in orthorhombic crystals
PDB Compounds: (A:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d2z9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9da_ c.23.5.3 (A:) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]}
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
emaakaqsdakaaidsivsa

SCOPe Domain Coordinates for d2z9da_:

Click to download the PDB-style file with coordinates for d2z9da_.
(The format of our PDB-style files is described here.)

Timeline for d2z9da_: