Lineage for d2z9ca1 (2z9c A:1-200)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 826033Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 826034Protein ACP phosphodiesterase AcpD [110470] (2 species)
    evolved new enzymatic activity
  7. 826035Species Escherichia coli [TaxId:562] [110471] (7 PDB entries)
    Uniprot P41407
  8. 826042Domain d2z9ca1: 2z9c A:1-200 [154238]
    automatically matched to d1tika_
    complexed with dtc, fmn, gol

Details for d2z9ca1

PDB Entry: 2z9c (more details), 2.3 Å

PDB Description: The crystal structure of AzoR (azoreductase) from Escherichia coli: AzoR in complex with dicoumarol
PDB Compounds: (A:) FMN-dependent NADH-azoreductase

SCOP Domain Sequences for d2z9ca1:

Sequence, based on SEQRES records: (download)

>d2z9ca1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]}
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
emaakaqsdakaaidsivsa

Sequence, based on observed residues (ATOM records): (download)

>d2z9ca1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]}
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalra
pltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfryten
gpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygpema
akaqsdakaaidsivsa

SCOP Domain Coordinates for d2z9ca1:

Click to download the PDB-style file with coordinates for d2z9ca1.
(The format of our PDB-style files is described here.)

Timeline for d2z9ca1: