Lineage for d2z9ab_ (2z9a B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2716985Protein Saposin C [89077] (1 species)
  7. 2716986Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)
  8. 2717001Domain d2z9ab_: 2z9a B: [154236]
    automated match to d1m12a_
    complexed with gol

Details for d2z9ab_

PDB Entry: 2z9a (more details), 2.5 Å

PDB Description: Crystal Structure of Human Saposin C Dimer in Open Conformation
PDB Compounds: (B:) Proactivator polypeptide

SCOPe Domain Sequences for d2z9ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9ab_ a.64.1.1 (B:) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
dvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssilsi
lleevspelvcsmlhlcs

SCOPe Domain Coordinates for d2z9ab_:

Click to download the PDB-style file with coordinates for d2z9ab_.
(The format of our PDB-style files is described here.)

Timeline for d2z9ab_: