Lineage for d2z92b2 (2z92 B:108-211)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786271Species Mouse (Mus musculus) [TaxId:10090] [88567] (318 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity
    SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
    Uniprot P01837 # KAC_MOUSE Ig kappa chain C region
    Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region
    SQ NA # part of Fab 28 against HIV-1 RT
    Uniprot P01837 #
    KAC_MOUSE Ig kappa chain C region
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 786406Domain d2z92b2: 2z92 B:108-211 [154227]
    Other proteins in same PDB: d2z92a1, d2z92b1
    automatically matched to d1dqdl2
    complexed with cit, ene

Details for d2z92b2

PDB Entry: 2z92 (more details), 2.3 Å

PDB Description: crystal structure of the fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c_abcde
PDB Compounds: (B:) Anti-ciguatoxin antibody 10C9 Fab light chain

SCOP Domain Sequences for d2z92b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z92b2 b.1.1.2 (B:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2z92b2:

Click to download the PDB-style file with coordinates for d2z92b2.
(The format of our PDB-style files is described here.)

Timeline for d2z92b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z92b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2z92a1