Lineage for d2z92b1 (2z92 B:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783142Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 783148Domain d2z92b1: 2z92 B:1-107 [154226]
    Other proteins in same PDB: d2z92a1, d2z92b2
    automatically matched to d1dqdl1
    complexed with cit, ene

Details for d2z92b1

PDB Entry: 2z92 (more details), 2.3 Å

PDB Description: crystal structure of the fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c_abcde
PDB Compounds: (B:) Anti-ciguatoxin antibody 10C9 Fab light chain

SCOP Domain Sequences for d2z92b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z92b1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevk

SCOP Domain Coordinates for d2z92b1:

Click to download the PDB-style file with coordinates for d2z92b1.
(The format of our PDB-style files is described here.)

Timeline for d2z92b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z92b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2z92a1