SCOPe 2.08: Domain d2z92b1: 2z92 B:1-107

Lineage for d2z92b1 (2z92 B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2z92b1: 2z92 B:1-107 [154226]
   Other proteins in same PDB: d2z92a1, d2z92b2
   automated match to d1h3pl1
   complexed with cit, ene

Details for d2z92b1

PDB Entry: 2z92, 2.3 Å

PDB Description: crystal structure of the fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c_abcde

PDB Compounds: (B:) Anti-ciguatoxin antibody 10C9 Fab light chain

SCOPe Domain Sequences for d2z92b1:

Sequence; same for both SEQRES and ATOM records:

>d2z92b1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevk

Timeline for d2z92b1:

• d2z92b1 first appeared in SCOP 1.75
  
• d2z92b1 appears in SCOPe 2.07