SCOPe 2.01: Domain d2z91b1: 2z91 B:1-107

Lineage for d2z91b1 (2z91 B:1-107)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d2z91b1: 2z91 B:1-107 [154220]
   Other proteins in same PDB: d2z91a1, d2z91b2, d2z91c1, d2z91d2
   automatically matched to d1dqdl1

Details for d2z91b1

PDB Entry: 2z91, 2.6 Å

PDB Description: Crystal structure of the Fab fragment of anti-ciguatoxin antibody 10C9

PDB Compounds: (B:) Anti-ciguatoxin antibody 10C9 Fab light chain

SCOPe Domain Sequences for d2z91b1:

Sequence; same for both SEQRES and ATOM records:

>d2z91b1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevk

Timeline for d2z91b1:

• d2z91b1 first appeared in SCOP 1.75
  
• d2z91b1 appears in SCOPe 2.02
  
• d2z91b1 appears in the current release, SCOPe 2.08