Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.26: Prismane protein-like [56820] (1 superfamily) 3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology |
Superfamily e.26.1: Prismane protein-like [56821] (4 families) |
Family e.26.1.3: Acetyl-CoA synthase [82852] (3 proteins) 4 domains: structures and assembly of domains 1 and 2 are similar to those of domains 1 and 3 of the CODH subunit; (3 and 4) alpha+beta |
Protein automated matches [190423] (1 species) not a true protein |
Species Moorella thermoacetica [TaxId:1525] [187305] (3 PDB entries) |
Domain d2z8yo_: 2z8y O: [154217] Other proteins in same PDB: d2z8ya_, d2z8yb_, d2z8yc_, d2z8yd_ automated match to d1oaoc_ complexed with cu1, gol, ni, sf4, xcc, xe |
PDB Entry: 2z8y (more details), 2.51 Å
SCOPe Domain Sequences for d2z8yo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8yo_ e.26.1.3 (O:) automated matches {Moorella thermoacetica [TaxId: 1525]} tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad ggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekghp altmdpi
Timeline for d2z8yo_: