![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.26: Prismane protein-like [56820] (1 superfamily) 3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology |
![]() | Superfamily e.26.1: Prismane protein-like [56821] (3 families) ![]() |
![]() | Family e.26.1.3: Acetyl-CoA synthase [82852] (3 proteins) 4 domains: structures and assembly of domains 1 and 2 are similar to those of domains 1 and 3 of the CODH subunit; (3 and 4) alpha+beta |
![]() | Protein automated matches [190423] (1 species) not a true protein |
![]() | Species Moorella thermoacetica [TaxId:1525] [187305] (3 PDB entries) |
![]() | Domain d2z8yn_: 2z8y N: [154216] Other proteins in same PDB: d2z8ya_, d2z8yb_, d2z8yc_, d2z8yd_ automated match to d1oaoc_ complexed with cu1, gol, ni, sf4, xcc, xe |
PDB Entry: 2z8y (more details), 2.51 Å
SCOPe Domain Sequences for d2z8yn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8yn_ e.26.1.3 (N:) automated matches {Moorella thermoacetica [TaxId: 1525]} tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad ggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekghp altmdpim
Timeline for d2z8yn_: