SCOPe 2.06: Domain d2z8ca1: 2z8c A:984-1283

Lineage for d2z8ca1 (2z8c A:984-1283)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Insulin receptor [56162] (1 species)
   PTK group; InsR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)

8. Domain d2z8ca1: 2z8c A:984-1283 [154208]
   automatically matched to d1gaga_
   complexed with s91

Details for d2z8ca1

PDB Entry: 2z8c, 3.25 Å

PDB Description: phosphorylated insulin receptor tyrosine kinase in complex with (4- {[5-carbamoyl-4-(3-methylanilino)pyrimidin-2-yl]amino}phenyl)acetic acid

PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d2z8ca1:

Sequence; same for both SEQRES and ATOM records:

>d2z8ca1 d.144.1.7 (A:984-1283) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
fvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerie
flneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrpp
ptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyy
rkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvm
dggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhseenk

Timeline for d2z8ca1:

• d2z8ca1 first appeared in SCOP 1.75
  
• d2z8ca1 appears in SCOPe 2.05
  
• d2z8ca1 appears in SCOPe 2.07
  
• d2z8ca1 appears in the current release, SCOPe 2.08