SCOP 1.75: Domain d2z7ya1: 2z7y A:1-151

Lineage for d2z7ya1 (2z7y A:1-151)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (21 PDB entries)

8. Domain d2z7ya1: 2z7y A:1-151 [154204]
   automatically matched to d1cbja_
   complexed with cu, zn

Details for d2z7ya1

PDB Entry: 2z7y, 1.55 Å

PDB Description: Crystal Structure of H2O2 treated Cu,Zn-SOD

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOP Domain Sequences for d2z7ya1:

Sequence; same for both SEQRES and ATOM records:

>d2z7ya1 b.1.8.1 (A:1-151) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d2z7ya1:

• d2z7ya1 is new in SCOP 1.75
  
• d2z7ya1 is called d2z7ya_ in SCOPe 2.01
  
• d2z7ya1 appears in the current release, SCOPe 2.08, called d2z7ya_