Lineage for d2z7ad_ (2z7a D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1640910Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 1641061Protein Hypothetical protein Rv0760c [142994] (2 species)
  7. 1641062Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [159979] (3 PDB entries)
  8. 1641072Domain d2z7ad_: 2z7a D: [154195]
    automated match to d2a15a1
    complexed with act

Details for d2z7ad_

PDB Entry: 2z7a (more details), 2.1 Å

PDB Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis at 2.10 Angstrom resolution
PDB Compounds: (D:) Putative steroid isomerase

SCOPe Domain Sequences for d2z7ad_:

Sequence, based on SEQRES records: (download)

>d2z7ad_ d.17.4.3 (D:) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
spaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffdt
hiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmrg
ywnldmmtf

Sequence, based on observed residues (ATOM records): (download)

>d2z7ad_ d.17.4.3 (D:) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
spaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffdt
hiaanrltvtceetfpssspdeiahilvlhsefftsevrgvftyrvnkaglitnmrgywn
ldmmtf

SCOPe Domain Coordinates for d2z7ad_:

Click to download the PDB-style file with coordinates for d2z7ad_.
(The format of our PDB-style files is described here.)

Timeline for d2z7ad_: