![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
![]() | Protein Hypothetical protein Rv0760c [142994] (2 species) |
![]() | Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [159979] (3 PDB entries) |
![]() | Domain d2z7aa_: 2z7a A: [154192] automated match to d2a15a1 complexed with act |
PDB Entry: 2z7a (more details), 2.1 Å
SCOPe Domain Sequences for d2z7aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z7aa_ d.17.4.3 (A:) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]} ttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaf fdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitn mrgywnldmmtfg
Timeline for d2z7aa_: