SCOP 1.75: Domain d2z77d1: 2z77 D:6-135

Lineage for d2z77d1 (2z77 D:6-135)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)

6. Protein Hypothetical protein Rv0760c [142994] (2 species)

7. Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [159979] (3 PDB entries)

8. Domain d2z77d1: 2z77 D:6-135 [154191]
   automatically matched to d2a15a1
   complexed with act, he7, nca

Details for d2z77d1

PDB Entry: 2z77, 2.03 Å

PDB Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis in complex with estradiol-17beta-hemisuccinate

PDB Compounds: (D:) Putative steroid isomerase

SCOP Domain Sequences for d2z77d1:

Sequence; same for both SEQRES and ATOM records:

>d2z77d1 d.17.4.3 (D:6-135) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
gywnldmmtf

Timeline for d2z77d1:

• d2z77d1 is new in SCOP 1.75
  
• d2z77d1 is called d2z77d_ in SCOPe 2.01
  
• d2z77d1 appears in the current release, SCOPe 2.08, called d2z77d_