Lineage for d2z77c1 (2z77 C:6-136)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855766Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 855825Protein Hypothetical protein Rv0760c [142994] (2 species)
  7. 855826Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [159979] (3 PDB entries)
  8. 855835Domain d2z77c1: 2z77 C:6-136 [154190]
    automatically matched to d2a15a1
    complexed with act, he7, nca

Details for d2z77c1

PDB Entry: 2z77 (more details), 2.03 Å

PDB Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis in complex with estradiol-17beta-hemisuccinate
PDB Compounds: (C:) Putative steroid isomerase

SCOP Domain Sequences for d2z77c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z77c1 d.17.4.3 (C:6-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
gywnldmmtfg

SCOP Domain Coordinates for d2z77c1:

Click to download the PDB-style file with coordinates for d2z77c1.
(The format of our PDB-style files is described here.)

Timeline for d2z77c1: