SCOPe 2.05: Domain d2z77a_: 2z77 A:

Lineage for d2z77a_ (2z77 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Hypothetical protein Rv0760c [142994] (2 species)

7. Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [159979] (3 PDB entries)

8. Domain d2z77a_: 2z77 A: [154188]
   automated match to d2a15a1
   complexed with act, he7, nca

Details for d2z77a_

PDB Entry: 2z77, 2.03 Å

PDB Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis in complex with estradiol-17beta-hemisuccinate

PDB Compounds: (A:) Putative steroid isomerase

SCOPe Domain Sequences for d2z77a_:

Sequence; same for both SEQRES and ATOM records:

>d2z77a_ d.17.4.3 (A:) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
gywnldmmtfgnq

Timeline for d2z77a_:

• d2z77a_ first appeared in SCOP 1.75, called d2z77a1
  
• d2z77a_ appears in SCOPe 2.04
  
• d2z77a_ appears in SCOPe 2.06
  
• d2z77a_ appears in the current release, SCOPe 2.08