Lineage for d2z76a_ (2z76 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020129Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 1020251Protein Hypothetical protein Rv0760c [142994] (2 species)
  7. 1020252Species Mycobacterium tuberculosis H37Rv [TaxId:83332] [159979] (3 PDB entries)
  8. 1020253Domain d2z76a_: 2z76 A: [154186]
    automated match to d2a15a1
    complexed with act, lda, mpd

Details for d2z76a_

PDB Entry: 2z76 (more details), 1.82 Å

PDB Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis at 1.82 Angstrom resolution
PDB Compounds: (A:) Putative steroid isomerase

SCOPe Domain Sequences for d2z76a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z76a_ d.17.4.3 (A:) Hypothetical protein Rv0760c {Mycobacterium tuberculosis H37Rv [TaxId: 83332]}
qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
gywnldmmtfg

SCOPe Domain Coordinates for d2z76a_:

Click to download the PDB-style file with coordinates for d2z76a_.
(The format of our PDB-style files is described here.)

Timeline for d2z76a_: