SCOPe 2.05: Domain d2z6sa_: 2z6s A:

Lineage for d2z6sa_ (2z6s A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
   Uniprot P02185

8. Domain d2z6sa_: 2z6s A: [154182]
   automated match to d104ma_
   complexed with hem, oxy, so4

Details for d2z6sa_

PDB Entry: 2z6s, 1.25 Å

PDB Description: Crystal structure of the oxy myoglobin free from X-ray-induced photoreduction

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2z6sa_:

Sequence; same for both SEQRES and ATOM records:

>d2z6sa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq

Timeline for d2z6sa_:

• d2z6sa_ first appeared in SCOP 1.75, called d2z6sa1
  
• d2z6sa_ appears in SCOPe 2.04
  
• d2z6sa_ appears in SCOPe 2.06
  
• d2z6sa_ appears in the current release, SCOPe 2.08