| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100977] (3 PDB entries) Uniprot P83133 |
| Domain d2z6nb_: 2z6n B: [154181] Other proteins in same PDB: d2z6na_ automated match to d1wmub_ complexed with cmo, hem |
PDB Entry: 2z6n (more details), 1.86 Å
SCOPe Domain Sequences for d2z6nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z6nb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv
lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk
eftpasqaawtklvnavahalalgyh
Timeline for d2z6nb_: