![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100976] (3 PDB entries) Uniprot P83134 |
![]() | Domain d2z6na_: 2z6n A: [154180] Other proteins in same PDB: d2z6nb_ automated match to d1v75a_ complexed with cmo, hem |
PDB Entry: 2z6n (more details), 1.86 Å
SCOPe Domain Sequences for d2z6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z6na_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq vqvaydkflaavsavlaekyr
Timeline for d2z6na_: