Lineage for d2z6na1 (2z6n A:1-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758540Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100976] (3 PDB entries)
    Uniprot P83134
  8. 758542Domain d2z6na1: 2z6n A:1-141 [154180]
    Other proteins in same PDB: d2z6nb1
    automatically matched to d1v75a_
    complexed with cmo, hem

Details for d2z6na1

PDB Entry: 2z6n (more details), 1.86 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin d from the aldabra giant tortoise, geochelone gigantea
PDB Compounds: (A:) Hemoglobin D subunit alpha

SCOP Domain Sequences for d2z6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6na1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
vqvaydkflaavsavlaekyr

SCOP Domain Coordinates for d2z6na1:

Click to download the PDB-style file with coordinates for d2z6na1.
(The format of our PDB-style files is described here.)

Timeline for d2z6na1: