SCOPe 2.08: Domain d2z6na_: 2z6n A:

Lineage for d2z6na_ (2z6n A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100976] (3 PDB entries)
   Uniprot P83134

8. Domain d2z6na_: 2z6n A: [154180]
   Other proteins in same PDB: d2z6nb_
   automated match to d1v75a_
   complexed with cmo, hem

Details for d2z6na_

PDB Entry: 2z6n, 1.86 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin d from the aldabra giant tortoise, geochelone gigantea

PDB Compounds: (A:) Hemoglobin D subunit alpha

SCOPe Domain Sequences for d2z6na_:

Sequence; same for both SEQRES and ATOM records:

>d2z6na_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
vqvaydkflaavsavlaekyr

Timeline for d2z6na_:

• d2z6na_ first appeared in SCOP 1.75, called d2z6na1
  
• d2z6na_ appears in SCOPe 2.07