SCOPe 2.03: Domain d2z6kd1: 2z6k D:3-117

Lineage for d2z6kd1 (2z6k D:3-117)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50272] (5 PDB entries)

8. Domain d2z6kd1: 2z6k D:3-117 [154179]
   Other proteins in same PDB: d2z6ka1, d2z6kb1
   automatically matched to d1l1oa_

Details for d2z6kd1

PDB Entry: 2z6k, 3 Å

PDB Description: Crystal structure of full-length human RPA14/32 heterodimer

PDB Compounds: (D:) Replication protein A 14 kDa subunit

SCOPe Domain Sequences for d2z6kd1:

Sequence; same for both SEQRES and ATOM records:

>d2z6kd1 b.40.4.3 (D:3-117) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi

Timeline for d2z6kd1:

• d2z6kd1 first appeared in SCOP 1.75
  
• d2z6kd1 appears in SCOPe 2.02
  
• d2z6kd1 is called d2z6kd_ in SCOPe 2.04
  
• d2z6kd1 appears in the current release, SCOPe 2.08, called d2z6kd_