Lineage for d2z67d_ (2z67 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132207Family c.67.1.9: SepSecS-like [159704] (2 protein domains)
    Pfam PF05889
  6. 2132208Protein Selenocysteinyl-tRNA synthase (SepSecS) [159705] (3 species)
  7. 2132214Species Methanococcus maripaludis [TaxId:39152] [159708] (1 PDB entry)
    Uniprot Q6LZM9 1-434
  8. 2132218Domain d2z67d_: 2z67 D: [154173]
    automated match to d2z67a1
    complexed with plp, so4

Details for d2z67d_

PDB Entry: 2z67 (more details), 2.5 Å

PDB Description: Crystal structure of archaeal O-phosphoseryl-tRNA(Sec) selenium transferase (SepSecS)
PDB Compounds: (D:) O-phosphoseryl-tRNA(Sec) selenium transferase

SCOPe Domain Sequences for d2z67d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z67d_ c.67.1.9 (D:) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]}
mldfnieglipknmekrgelvlneylkeiedvfnhrkipengiddekiklflkflsmmdt
dkdpksvrigereartyskiheelssgfchgigrsgnlvdpqpkasgasimyaltnkile
sffkqlglnvhaiatpistgmsislclsaarkkygsnvviypyashkspikavsfvgmnm
rlvetvldgdrvyvpvedienaikkeielgnrpcvlstltffpprnsddiveiakiceny
diphiingayaiqnnyyleklkkafkyrvdavvsssdknlltpiggglvystdaefikei
slsypgrasatpvvntlvsllsmgsknylelvknqknskklldellndlskktggkfldv
espiascisvnsdpveiaaklynlrvtgprgikktdhfgncylgtythdyivmnaaigvr
tedivnsvskleki

SCOPe Domain Coordinates for d2z67d_:

Click to download the PDB-style file with coordinates for d2z67d_.
(The format of our PDB-style files is described here.)

Timeline for d2z67d_: