Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) |
Family c.67.1.9: SepSecS-like [159704] (1 protein) Pfam PF05889 |
Protein Selenocysteinyl-tRNA synthase (SepSecS) [159705] (3 species) |
Species Methanococcus maripaludis [TaxId:39152] [159708] (1 PDB entry) Uniprot Q6LZM9 1-434 |
Domain d2z67b1: 2z67 B:1-434 [154171] automatically matched to 2Z67 A:1-434 complexed with plp, so4 |
PDB Entry: 2z67 (more details), 2.5 Å
SCOP Domain Sequences for d2z67b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z67b1 c.67.1.9 (B:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} mldfnieglipknmekrgelvlneylkeiedvfnhrkipengiddekiklflkflsmmdt dkdpksvrigereartyskiheelssgfchgigrsgnlvdpqpkasgasimyaltnkile sffkqlglnvhaiatpistgmsislclsaarkkygsnvviypyashkspikavsfvgmnm rlvetvldgdrvyvpvedienaikkeielgnrpcvlstltffpprnsddiveiakiceny diphiingayaiqnnyyleklkkafkyrvdavvsssdknlltpiggglvystdaefikei slsypgrasatpvvntlvsllsmgsknylelvknqknskklldellndlskktggkfldv espiascisvnsdpveiaaklynlrvtgprgikktdhfgncylgtythdyivmnaaigvr tedivnsvskleki
Timeline for d2z67b1: