Lineage for d2z5ua2 (2z5u A:274-654,A:764-831)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096593Protein Lysine-specific histone demethylase 1, LSD1 [159432] (1 species)
  7. 2096594Species Human (Homo sapiens) [TaxId:9606] [159433] (27 PDB entries)
    Uniprot O60341 274-654,764-836
  8. 2096597Domain d2z5ua2: 2z5u A:274-654,A:764-831 [154168]
    Other proteins in same PDB: d2z5ua1, d2z5ua3
    automatically matched to 2IW5 A:274-654,A:764-836
    complexed with faj

Details for d2z5ua2

PDB Entry: 2z5u (more details), 2.25 Å

PDB Description: Crystal structure of Lysine-specific histone demethylase 1
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2z5ua2:

Sequence, based on SEQRES records: (download)

>d2z5ua2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
ptkktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamv
vtglggnpmavvskqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsyls
hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlke
kikelhqqykeasevkpprditaeflvkskhrdltalckeydelaetqgkleeklqelea
nppsdvylssrdrqildwhfanlefanatplstlslkhwdqdddfeftgshltvrngysc
vpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqq
ppavqfvpplpewktsavqrmXvaagssgndydlmaqpitpgpsipgapqpiprlffage
htirnypatvhgallsglreagriadqflg

Sequence, based on observed residues (ATOM records): (download)

>d2z5ua2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
ptkktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamv
vtglggnpmavvskqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsyls
hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlke
kikelhqqykeitaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvyls
srdrqildwhfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegl
diklntavrqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpp
lpewktsavqrmXvaagssgndydlmaqpitppiprlffagehtirnypatvhgallsgl
reagriadqflg

SCOPe Domain Coordinates for d2z5ua2:

Click to download the PDB-style file with coordinates for d2z5ua2.
(The format of our PDB-style files is described here.)

Timeline for d2z5ua2: