Lineage for d2z5ua1 (2z5u A:172-273)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761800Family a.4.1.18: SWIRM domain [140222] (3 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 761801Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 761802Species Human (Homo sapiens) [TaxId:9606] [140228] (9 PDB entries)
    Uniprot O60341 169-279
  8. 761805Domain d2z5ua1: 2z5u A:172-273 [154167]
    Other proteins in same PDB: d2z5ua2, d2z5ua3
    automatically matched to 2IW5 A:171-273
    complexed with fa9

Details for d2z5ua1

PDB Entry: 2z5u (more details), 2.25 Å

PDB Description: crystal structure of lysine-specific histone demethylase 1
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOP Domain Sequences for d2z5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z5ua1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOP Domain Coordinates for d2z5ua1:

Click to download the PDB-style file with coordinates for d2z5ua1.
(The format of our PDB-style files is described here.)

Timeline for d2z5ua1: