SCOPe 2.08: Domain d2z5ha1: 2z5h A:234-281

Lineage for d2z5ha1 (2z5h A:234-281)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.5: Tropomyosin [57997] (2 families)

5. Family h.1.5.1: Tropomyosin [57998] (1 protein)

6. Protein Tropomyosin [57999] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161252] (1 PDB entry)

8. Domain d2z5ha1: 2z5h A:234-281 [154163]
   Other proteins in same PDB: d2z5ha2
   automatically matched to d1kqla_

Details for d2z5ha1

PDB Entry: 2z5h, 2.89 Å

PDB Description: crystal structure of the head-to-tail junction of tropomyosin complexed with a fragment of tnt

PDB Compounds: (A:) General control protein GCN4 and Tropomyosin alpha-1 chain

SCOPe Domain Sequences for d2z5ha1:

Sequence; same for both SEQRES and ATOM records:

>d2z5ha1 h.1.5.1 (A:234-281) Tropomyosin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndm

Timeline for d2z5ha1:

• d2z5ha1 first appeared in SCOP 1.75
  
• d2z5ha1 appears in SCOPe 2.07