Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Escherichia coli [TaxId:562] [159474] (29 PDB entries) Uniprot P02410 1-140 |
Domain d2z4nj1: 2z4n J:1-140 [154142] Other proteins in same PDB: d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nc1, d2z4nc2, d2z4nd1, d2z4ne1, d2z4nf1, d2z4ng1, d2z4ng2, d2z4nh1, d2z4nh2, d2z4ni1, d2z4ni2, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2z4n (more details), 4.45 Å
SCOPe Domain Sequences for d2z4nj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4nj1 c.21.1.1 (J:1-140) Ribosomal protein L13 {Escherichia coli [TaxId: 562]} mktftakpetvkrdwyvvdatgktlgrlatelarrlrgkhkaeytphvdtgdyiivlnad kvavtgnkrtdkvyyhhtghiggikqatfeemiarrpervieiavkgmlpkgplgramfr klkvyagnehnhaaqqpqvl
Timeline for d2z4nj1:
View in 3D Domains from other chains: (mouse over for more information) d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nc1, d2z4nc2, d2z4nd1, d2z4ne1, d2z4nf1, d2z4ng1, d2z4ng2, d2z4nh1, d2z4nh2, d2z4ni1, d2z4ni2, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1 |