Lineage for d2z4nh2 (2z4n H:1-58)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869343Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 869344Superfamily d.100.1: L9 N-domain-like [55658] (2 families) (S)
  5. 869345Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 869346Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 869358Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 869382Domain d2z4nh2: 2z4n H:1-58 [154139]
    Other proteins in same PDB: d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nc1, d2z4nc2, d2z4nd1, d2z4ne1, d2z4nf1, d2z4ng1, d2z4ng2, d2z4nh1, d2z4ni1, d2z4ni2, d2z4nj1, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1
    automatically matched to 2AW4 H:1-58
    complexed with mg, par, zn

Details for d2z4nh2

PDB Entry: 2z4n (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with paromomycin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 50S ribosomal protein L9

SCOP Domain Sequences for d2z4nh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4nh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOP Domain Coordinates for d2z4nh2:

Click to download the PDB-style file with coordinates for d2z4nh2.
(The format of our PDB-style files is described here.)

Timeline for d2z4nh2: