Lineage for d2z4ng2 (2z4n G:82-176)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217079Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2217080Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2217081Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2217082Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2217099Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 2217145Domain d2z4ng2: 2z4n G:82-176 [154137]
    Other proteins in same PDB: d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nc1, d2z4nc2, d2z4nd1, d2z4ne1, d2z4nf1, d2z4nh1, d2z4nh2, d2z4ni1, d2z4ni2, d2z4nj1, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1
    protein/RNA complex; complexed with mg, par, zn
    protein/RNA complex; complexed with mg, par, zn

Details for d2z4ng2

PDB Entry: 2z4n (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with paromomycin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2z4ng2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4ng2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

SCOPe Domain Coordinates for d2z4ng2:

Click to download the PDB-style file with coordinates for d2z4ng2.
(The format of our PDB-style files is described here.)

Timeline for d2z4ng2: