Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Escherichia coli [TaxId:562] [159159] (29 PDB entries) Uniprot P60438 1-209 |
Domain d2z4nd1: 2z4n D:1-209 [154133] Other proteins in same PDB: d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nc1, d2z4nc2, d2z4ne1, d2z4nf1, d2z4ng1, d2z4ng2, d2z4nh1, d2z4nh2, d2z4ni1, d2z4ni2, d2z4nj1, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1 automatically matched to 2AW4 D:1-209 complexed with mg, par, zn |
PDB Entry: 2z4n (more details), 4.45 Å
SCOP Domain Sequences for d2z4nd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4nd1 b.43.3.2 (D:1-209) Ribosomal protein L3 {Escherichia coli [TaxId: 562]} miglvgkkvgmtriftedgvsipvtvieveanrvtqvkdlandgyraiqvttgakkanrv tkpeaghfakagveagrglwefrlaegeeftvgqsisvelfadvkkvdvtgtskgkgfag tvkrwnfrtqdathgnslshrvpgsigqnqtpgkvfkgkkmagqmgnervtvqsldvvrv daernlllvkgavpgatgsdlivkpavka
Timeline for d2z4nd1:
View in 3D Domains from other chains: (mouse over for more information) d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nc1, d2z4nc2, d2z4ne1, d2z4nf1, d2z4ng1, d2z4ng2, d2z4nh1, d2z4nh2, d2z4ni1, d2z4ni2, d2z4nj1, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1 |