| Root: SCOPe 2.07 |
| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
| Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
| Species Escherichia coli [TaxId:562] [159086] (27 PDB entries) Uniprot P60422 3-124 |
| Domain d2z4nc2: 2z4n C:61-124 [154132] Other proteins in same PDB: d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nc1, d2z4nd1, d2z4ne1, d2z4nf1, d2z4ng1, d2z4ng2, d2z4nh1, d2z4nh2, d2z4ni1, d2z4ni2, d2z4nj1, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2z4n (more details), 4.45 Å
SCOPe Domain Sequences for d2z4nc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4nc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik
Timeline for d2z4nc2:
View in 3DDomains from other chains: (mouse over for more information) d2z4n01, d2z4n11, d2z4n31, d2z4n41, d2z4n61, d2z4nd1, d2z4ne1, d2z4nf1, d2z4ng1, d2z4ng2, d2z4nh1, d2z4nh2, d2z4ni1, d2z4ni2, d2z4nj1, d2z4nk1, d2z4nl1, d2z4nm1, d2z4nn1, d2z4no1, d2z4np1, d2z4nq1, d2z4nr1, d2z4ns1, d2z4nt1, d2z4nu1, d2z4nv1, d2z4nw1, d2z4nx1, d2z4ny1, d2z4nz1 |