Lineage for d2z4mr1 (2z4m R:19-73)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480558Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1480559Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1480560Protein Ribosomal protein S18 [46913] (2 species)
  7. 1480561Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1480584Domain d2z4mr1: 2z4m R:19-73 [154122]
    Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4ms1, d2z4mt1, d2z4mu1
    automatically matched to 2AVY R:19-73
    protein/RNA complex; complexed with mg, par

Details for d2z4mr1

PDB Entry: 2z4m (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2z4mr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4mr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d2z4mr1:

Click to download the PDB-style file with coordinates for d2z4mr1.
(The format of our PDB-style files is described here.)

Timeline for d2z4mr1: