Lineage for d1gcwa_ (1gcw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686366Species Houndshark (Mustelus griseus) [TaxId:89020] [46499] (2 PDB entries)
  8. 2686369Domain d1gcwa_: 1gcw A: [15412]
    Other proteins in same PDB: d1gcwb_, d1gcwd_
    complexed with cmo, hem

Details for d1gcwa_

PDB Entry: 1gcw (more details), 2 Å

PDB Description: CO form hemoglobin from mustelus griseus
PDB Compounds: (A:) protein (hemoglobin)

SCOPe Domain Sequences for d1gcwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcwa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
hcavdkllsaicqelssryr

SCOPe Domain Coordinates for d1gcwa_:

Click to download the PDB-style file with coordinates for d1gcwa_.
(The format of our PDB-style files is described here.)

Timeline for d1gcwa_: