![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
![]() | Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
![]() | Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
![]() | Domain d2z4md1: 2z4m D:1-205 [154108] Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1 automatically matched to 2AVY D:1-205 complexed with mg, par |
PDB Entry: 2z4m (more details), 4.45 Å
SCOP Domain Sequences for d2z4md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4md1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d2z4md1: