![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160236] (24 PDB entries) Uniprot P0A7V3 1-105 |
![]() | Domain d2z4mc1: 2z4m C:1-105 [154106] Other proteins in same PDB: d2z4mb1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1 protein/RNA complex; complexed with mg, par protein/RNA complex; complexed with mg, par |
PDB Entry: 2z4m (more details), 4.45 Å
SCOPe Domain Sequences for d2z4mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4mc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]} gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev
Timeline for d2z4mc1: